AntiFungal Webserver

A simple but useful Webserver for antifungal peptide prediction&discovery&design.


Database of predicted peptides


Peptide sequence AntiFungal Candida albicans Candida parapsilosis Cryptococcus neoformans Candida krusei Anti-fungal index
Prediction [Probability(%)] Activity(μM) [Probability(%)] Activity(μM) [Probability(%)] Activity(μM) [Probability(%)] Activity(μM) [Probability(%)] Prediction(μM) [Probability(%)]
RCGNKRTRGIKKWVKGVAKGVAKDLAKKIL True [99.60%] 53.42 μM [94.40%] 13.32 μM [84.10%] 16.92 μM [81.90%] 70.74 μM [86.20%] 30.38 μM [55.80%]
RCGNKRTRGIAKFLDSAKKFGKKFVKTIMQL True [96.90%] 30.45 μM [94.30%] 13.47 μM [81.70%] 22.30 μM [80.90%] 124.78 μM [86.50%] 32.69 μM [52.20%]
AAFDCGGAAAAAAGAGA False [34.40%] 173.88 μM [98.90%] 52.51 μM [86.10%] 12.22 μM [99.40%] 29.53 μM [90.70%] 42.60 μM [26.40%]
VTTRRRKKEGEY False [41.10%] 57.99 μM [99.70%] 37.43 μM [87.70%] 18.69 μM [99.10%] 90.60 μM [80.20%] 43.79 μM [28.60%]
AVPQRDMPIQA False [0.60%] 59.82 μM [99.00%] 40.53 μM [86.80%] 31.26 μM [98.60%] 174.09 μM [59.00%] 60.27 μM [0.30%]
AFASHHAPPDEAGAAGA False [19.10%] 478.46 μM [99.70%] 35.59 μM [92.00%] 11.89 μM [99.50%] 100.70 μM [77.80%] 67.20 μM [13.60%]
VVPQRDMPIQA False [1.00%] 73.73 μM [98.80%] 46.25 μM [82.80%] 35.88 μM [98.70%] 205.51 μM [53.10%] 70.81 μM [0.40%]