AntiFungal Webserver

A simple but useful Webserver for antifungal peptide prediction&discovery&design.


Database of antifungal peptides


Peptide sequence Source
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRF DRAMP
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY APD3
YSRCQLQGFNCVVRSYGLPTIPCCRGSYFPGSTYGRCQRP CAMP
YSSGYTRPLPKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHR APD3
YSSKDCLKDIGKGIGAGTVAGAAGGGLAAGLGAIPGAFVGAHFGVIGGSAACIGGLLGN APD3
YSWPRMPRIPRLPRYPRYPRYPRWPRHPTIYA APD3
YSWPRMPRIPRLPRYPRYPRYPRWPRWPRQPTIYA APD3
YSYKKIDCGGACAARCRLSSRPRLCNRACGTCCARCNCVPPGTSGNTETCPCYASLTTHGNKRKCP APD3
YVDREINLFDHYCIISRSPHISRWELKWQATVTCPGWTPVKGKVRGYSNPLSAEREATRDFVQRIVQRGLVTRDEASEWL APD3
YVPKIPKPQPNKPNFPSFPGHGPFNPHASRFPR DBAASP
YVPKIPKPQPNKPNFPSFPGHGPFNPHASRFPRSPKDNGKIVFDAKKEGGKTQWNVETQQKVWGNKHGSIHVSAGAGKQPGGKPQGQVGIGGSFSWGK APD3
YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY APD3
YVPPVQKPHPNGPKFPTFP APD3
YVRTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKTCYCLVNC DBAASP
YVSCLFRGARCRVYSGRSCCFGYYCRRDFPGSIFGTCSRRNF APD3
YYHFWHRGVTKRSLSPHRPRHSRLQR APD3