AntiFungal Webserver

A simple but useful Webserver for antifungal peptide prediction&discovery&design.


Database of antifungal peptides


Peptide sequence Source
AAKMAKNVDKPLFTATFNVQASSADYATFIAGIRNKLRNPAHFSHNEPVLPPVEPNVPPSRWFHVVLKASPTSAGLTLAIRADNIYLEGFKSSDGTWWELTPGLIPGATYVGFGGTYRDLLGDTDKLTNVALGRQQLEDAVTALHGRTKADKASGPKQQQAREAVTTLLLMVNEATRFQTVSGFVAGLLHPKAVEKKSGKIGNEMKAQVNGWQDLSAALLKTDVKPPPGKSPAKFTPIEKMGVRTAEQAAATLGI CAMP
AAKMAKNVDKPLFTATFNVQASSADYATFIAGIRNKLRNPAHFSHNRPVLPPVEPNVPPSRWFHVVLKASPTSAGLTLAIRADNIYLEGFKSSDGTWWELTPGLIPGATYVGFGGTYRDLLGDTDKLTNVALGRQQLADAVTALHGRTKADKPSGPKQQQAREAVTTLLLMVNEATRFQTVSGFVAGLLHPKAVEKKSGKIGNEMKAQVNGWQDLSAALLKTDVKPPPGKSPAKFAPIEKMGVRTAVQAANTLGI CAMP
AAKPMGITCDLLSLWKVGHAACAAHCLVLGDVGGYCTKEGLCVCKE APD3
AALKGCWTKSIPPKPCFGF DBAASP
AALKGCWTKSIPPKPCFGKR APD3
AALKGCWTKSIPPKPCSGKR APD3
AALRGALRAVARVGKAILPHVAIANPYVRTPYVHNNP DRAMP
AALRGCWTKSIPPKPCPGKR APD3
AALRGCWTKSIPPKPCSGKR APD3
AANFGPSVFTPEVHETWQKFLNVVVAALGKQYH APD3
AAPRGGKGFFCKLFKDC APD3
AARIILRARFR DBAASP
AARIILRDRFR DBAASP
AARIILRFRFR DBAASP
AARIILRGRFR DBAASP
AARIILRIRFR DBAASP
AARIILRLRFR DBAASP
AARIILRNRFR DBAASP
AARIILRPRFR DBAASP
AARIILRRRFR DBAASP