AntiFungal Webserver

A simple but useful Webserver for antifungal peptide prediction&discovery&design.


Database of antifungal peptides


Peptide sequence Source
AAAAAAAAAK DBAASP
AAAAGSCVWGAVNYTSDCAAECKRRGYKGGHCGSFANVNCWCET DBAASP
AAAAGSCVWGAVNYTSDCAAECKRRGYKGGHCGSFANVNCWCRT DBAASP
AAAAGSCVWGAVNYTSDCAAECLLRGYKGGHCGSFANVNCWCET DBAASP
AAAAGSCVWGAVNYTSDCAAECLLRGYKGGHCGSFANVNCWCRT DBAASP
AAAAGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET DBAASP
AAAAGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCRT DBAASP
AAAAGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET DBAASP
AAAAGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCRT DBAASP
AACARFIDDFCDTLTPNIYRPRDNGQRCYAVNGHRCDFTVFNTNNGGNPIRASTPNCKTVLRTAANRCPTGGRGKINPNAPFLFAIDPNDGDCSTNF APD3
AACSDRAHGHICESFKSFCKDSGRNGVKLRANCKKTCGLC APD3
AACSLGSLLNVGCNSCACAAHCLATRGKNGACNSQRRCVCNK DBAASP
AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR APD3
AAFRGCWTKNYSPKPCL APD3
AAGGVKKPKKAAAAKKSPKKPKKPAAA APD3
AAGKGLVSNLLEK APD3
AAGMGFFGAR APD3
AAKIILNPKFR DBAASP
AAKIILNPKFRCFAAFC DBAASP
AAKIILNPKFRCKAAFC APD3