AntiFungal Webserver

A simple but useful Webserver for antifungal peptide prediction&discovery&design.


Database of Candida parapsilosis


Peptide sequence Target Activity type Activity value Unit
KRLFKKLLFSLRKY Candida parapsilosis ATCC 90018 IC50 1.2±0.8 µM
SSSKEENRIIPGGI Candida parapsilosis ATCC 90018 IC50 >123 µM
AKRHHGYKRKFH Candida parapsilosis ATCC 22019 MIC >100 µg/ml
AKRHHGYKRKFH Candida parapsilosis 98-2305 MIC 3.1 µg/ml
AKRHHGYKRKFH Candida parapsilosis 98-2318 MIC 3.1 µg/ml
AKRHHGYKRKFH Candida parapsilosis 98-2297 MIC 3.1 µg/ml
AGLQFPVGRVHRLLRK Candida parapsilosis ATCC 22019 MIC 25.0 µM
KKVVFKVKFKK Candida parapsilosis 96-819 MFC 8 µg/ml
KKVVFKVKFKK Candida parapsilosis 96-812 MFC >32 µg/ml
KKVVFKVKFKK Candida parapsilosis 96-819 MFC 8 µg/ml
KKVVFKVKFKK Candida parapsilosis 96-812 MFC 32 µg/ml
CFQWQRNMRKVR Candida parapsilosis ATCC 22019 MFC 100 µg/ml
CFQWKRAMRKVR Candida parapsilosis ATCC 22019 MFC 12 µg/ml
KRFHSVGSLIQRLQQMIRDLSEATRHGIRKITRPKLLLAS Candida parapsilosis MIC >150 µg/ml
GMWKKILGHLIR Candida parapsilosis Z150/119/IDE99 MIC 15±5 µM
GMWKKILGKLIR Candida parapsilosis Z150/119/IDE99 MIC 40 µM
VNWKKILGKIIKVVK Candida parapsilosis Z150/119/IDE99 MIC 53±34 µM
KNWKKGLGKGIKGVK Candida parapsilosis Z150/119/IDE99 MIC 45±15 µM
FLPILASLAAKFGPKLFSLVTKKS Candida parapsilosis ATCC 22019 MIC 40 µM
FLPILASLAAKFGPKLFSLVTKKS Candida parapsilosis MIC >40 µM