AntiFungal Webserver

A simple but useful Webserver for antifungal peptide prediction&discovery&design.


Database of Candida krusei


Peptide sequence Target Activity type Activity value Unit
FLPILASLAAKFGPKLFSLVTKKS Candida krusei ATCC 6258 MIC >40 µM
FLPILASLAAKFGPKLFSLVTKKS Candida krusei MIC >40 µM
DSHAKRHHGYKIKFHENHHSHRGY Candida krusei ED50 56.4 µM
DSHAKRHHGYKIKFHEKHHSLRGY Candida krusei ED50 9.5 µM
EGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCR Candida krusei ED50 3.82 µM
KQSHKKGGHSFPKEKIS Candida krusei IOC 4559 MIC 40-80 µg/ml
KMDSRWRWKSSKK Candida krusei IOC 4559 MIC 40-80 µg/ml
FVPWFSKFLGRIL Candida krusei ATCC 6258 MIC 3.125 µM
KWGWKGVKGVK Candida krusei ATCC 6258 MIC 19.53 µM
KWGWKGWKGVK Candida krusei ATCC 6258 MIC 19.53 µM
KWGWKGVKGAK Candida krusei ATCC 6258 MIC 31.25 µM
KAGWKGVKGAK Candida krusei ATCC 6258 MIC 31.25 µM
KWGWKGAKGAK Candida krusei ATCC 6258 MIC 15.62 µM
RGGLCYCRGRFCVCVGR Candida krusei KCTC 50633 MIC 4 µg/ml
KIFGAIWPLALGALKNLIK Candida krusei ATCC 6258 MIC 8 µM
GGYKGPYTRPILRPYVRPVSYNA Candida krusei MIC >50 µM
HSSGYTRPLRKPSRPIFIRPIG Candida krusei MIC 5-10 µM
IKKILSKIKKLLK Candida krusei CCM 8271 MIC 7.8 µg/ml
GWLDVAKKIGKAAFNVAKNFI Candida krusei ATCC 6258 MIC 16 µM
GWLDVAKKIGKAAFNVAKNFI Candida krusei ATCC 6258 MIC 16 µM